LITHIUM.AjaxSupport.fromLink('#kudoEntity_3', 'kudoEntity', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {}, 'oQbl7Wdm5RGZWJMDEWnI3X2EJL4Vka3x_X5niAQ27NY. ] { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2437568,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. // console.log(key); "event" : "addMessageUserEmailSubscription", { "context" : "envParam:feedbackData", "context" : "envParam:quiltName,expandedQuiltName", { "action" : "rerender" }, "context" : "envParam:quiltName", ] "showCountOnly" : "false", } ] ] } $(document).ready(function(){ } Sofortige Portierung der Handynummer: So funktioniert es richtig Bild: teltarif.de Eine Handynummer kann nicht nur zum En­de des bisherigen Vertrages zu einem an­de­ren Anbieter übertragen werden, sondern auch schon während einer laufen­den Ver­trags­beziehung. LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_7","componentSelector":"#lineardisplaymessageviewwrapper_7","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2443863,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. watching = false; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_40","feedbackSelector":".InfoMessage"}); { }, ] Bist du sicher, dass du fortfahren möchtest? { { "action" : "rerender" "linkDisabled" : "false" { "actions" : [ { }); }, "componentId" : "kudos.widget.button", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_49","feedbackSelector":".InfoMessage"}); "useTruncatedSubject" : "true", LITHIUM.InputEditForm("form", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. } ] "action" : "rerender" { }, } "useTruncatedSubject" : "true", { "action" : "rerender" "context" : "", "eventActions" : [ "action" : "rerender" "useCountToKudo" : "false", "actions" : [ LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { "actions" : [ { }, { { }, "event" : "approveMessage", }, { } "context" : "envParam:entity", ","loaderSelector":"#lineardisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { { if (event.target.matches('.redirect')) { { LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'ITaJDd2FhJmhPRkuHd91S7FGTUSEXZFF8FtcirPnPNc. $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); Bei weiteren Fragen wenden Sie sich bitte direkt an Arcor: postmaster@arcor.de. "context" : "", ] } "event" : "approveMessage", }, "entity" : "2438892", "action" : "pulsate" } ] "actions" : [ Du musst also nichts machen, bis auf kleine Anpas­sungen wie z.B. { "disableLinks" : "false", "action" : "rerender" }, "action" : "rerender" { ', 'ajax'); "event" : "RevokeSolutionAction", { ] ] "action" : "rerender" "context" : "lia-deleted-state", "disableLinks" : "false", "dialogKey" : "dialogKey" "buttonDialogCloseAlt" : "Schließen", }, ] }, "eventActions" : [ { } { $(this).toggleClass('active'); "action" : "rerender" } } "event" : "RevokeSolutionAction", "event" : "expandMessage", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); ], }, { Du findest die korrekten Server-Daten auf unserer Hilfe-Seite. "event" : "expandMessage", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", watching = false; { Als neu kennzeichnen; Lesezeichen; Abonnieren; RSS-Feed abonnieren; Kennzeichnen; Drucken; Per E-Mail an einen Freund senden; Anstößigen Inhalt melden; Login in den Router geht nicht ‎23.06.2019 16:07. "event" : "MessagesWidgetEditAction", }, "actions" : [ { }); "action" : "rerender" "context" : "envParam:quiltName,expandedQuiltName", "displaySubject" : "true", "action" : "rerender" "context" : "envParam:quiltName", "componentId" : "kudos.widget.button", }, lithadmin: [] { LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2436952 .lia-rating-control-passive', '#form_1'); "action" : "rerender" "action" : "rerender" { ] "context" : "", } "event" : "approveMessage", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); "actions" : [ }, { "event" : "removeMessageUserEmailSubscription", "revokeMode" : "true", } } } Gib bitte Deinen Benutzernamen ein. { "selector" : "#messageview_3", ] "eventActions" : [ ] ], "context" : "", "event" : "unapproveMessage", "disallowZeroCount" : "false", "event" : "ProductAnswerComment", } "event" : "deleteMessage", } "disableLabelLinks" : "false", { ] { ], ] "kudosLinksDisabled" : "false", Erfahren Sie hier, was Sie in diesem Fall tun können. ] { ] "displayStyle" : "horizontal", LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditCommentForm", "actions" : [ "context" : "envParam:feedbackData", }); "event" : "kudoEntity", "context" : "", "initiatorDataMatcher" : "data-lia-message-uid" Bist du sicher, dass du fortfahren möchtest? "context" : "lia-deleted-state", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ "selector" : "#messageview_4", { "context" : "envParam:quiltName,message", count = 0; { } "action" : "rerender" "event" : "addThreadUserEmailSubscription", { "disableLabelLinks" : "false", "event" : "addThreadUserEmailSubscription", "parameters" : { { ] }, "event" : "MessagesWidgetEditCommentForm", { ] }, LITHIUM.StarRating('#any_0_7', true, 2, 'LITHIUM:starRating'); "context" : "", } $(document).keydown(function(e) { "action" : "rerender" "actions" : [ "}); "showCountOnly" : "false", "context" : "envParam:quiltName,message", { LITHIUM.Dialog.options['651587383'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; //$('#community-menu-toggle').removeClass('active') "parameters" : { { "linkDisabled" : "false" } "context" : "lia-deleted-state", } } LITHIUM.Dialog.options['653921445'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; } /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] { }, { "useSubjectIcons" : "true", ] ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_37","feedbackSelector":".InfoMessage"}); "}); "truncateBody" : "true", "context" : "envParam:quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", "action" : "rerender" "event" : "RevokeSolutionAction", "actions" : [ $(document).ready(function(){ LITHIUM.AjaxSupport.fromLink('#kudoEntity_8', 'kudoEntity', '#ajaxfeedback_8', 'LITHIUM:ajaxError', {}, 'ITaJDd2FhJmhPRkuHd91S7FGTUSEXZFF8FtcirPnPNc. } "action" : "pulsate" ] "action" : "rerender" "event" : "unapproveMessage", "event" : "unapproveMessage", "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "kudoEntity", { { "event" : "editProductMessage", 5Mbit). "action" : "rerender" "event" : "removeThreadUserEmailSubscription", } LITHIUM.StarRating('#any_0_8', true, 2, 'LITHIUM:starRating'); "action" : "rerender" { { "componentId" : "forums.widget.message-view", } "actions" : [ "action" : "rerender" "linkDisabled" : "false" LITHIUM.AjaxSupport.ComponentEvents.set({ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Sv4xSB8W1vIAs2rVlBcFcPg5hdT6lDGv7e-N_9ImV78. })(LITHIUM.jQuery); "action" : "rerender" "parameters" : { }); }; "parameters" : { { Das passiert im Zeit­raum von Anfang Oktober bis Dezember 2020 in der Nacht. "actions" : [ }); { }, "dialogContentCssClass" : "lia-panel-dialog-content", "actions" : [ "context" : "envParam:quiltName", watching = false; ] "actions" : [ "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "actions" : [ ;(function($) { ] ;(function($) { "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" { LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2436470,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] { ', 'ajax'); "actions" : [ }, "action" : "rerender" }; "action" : "rerender" "defaultAriaLabel" : "", { "action" : "pulsate" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); } "context" : "", }, LITHIUM.MessageBodyDisplay('#bodyDisplay_8', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); }); "context" : "lia-deleted-state", { "dialogKey" : "dialogKey" { "action" : "rerender" "action" : "pulsate" "actions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Sv4xSB8W1vIAs2rVlBcFcPg5hdT6lDGv7e-N_9ImV78. "}); LITHIUM.Dialog.options['-1056731029'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { "initiatorDataMatcher" : "data-lia-message-uid" }, "context" : "envParam:quiltName", }, { "action" : "rerender" "actions" : [ { ] "event" : "addMessageUserEmailSubscription", "actions" : [ ] ] } ] }, } else { } } "actions" : [ } $(this).toggleClass("view-btn-open view-btn-close"); "event" : "ProductMessageEdit", { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); "event" : "markAsSpamWithoutRedirect", "context" : "", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_2","componentSelector":"#lineardisplaymessageviewwrapper_2","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2437501,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":2437568,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "useTruncatedSubject" : "true", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "actions" : [ }, ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OSXpRZmiYwYsfCs_CwB4pdvz_CWsBDEwplHs6YvUQSk. { ] "event" : "MessagesWidgetMessageEdit", "action" : "rerender" } "action" : "pulsate" ] "parameters" : { { "}); { "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { }, ] ] }, ;(function($) { ] Bitte ändern Sie ihr Email-Passwort und richten Outlook neu ein. { "action" : "rerender" "context" : "envParam:selectedMessage", ] } } else { { { "action" : "rerender" "disableKudosForAnonUser" : "false", "action" : "rerender" }); { }, "useCountToKudo" : "false", ] "quiltName" : "ForumMessage", }, "event" : "markAsSpamWithoutRedirect", { ;(function($){ { } "actions" : [ "action" : "pulsate" "event" : "editProductMessage", }, } { "displayStyle" : "horizontal", } "actions" : [ "event" : "ProductAnswer", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetEditAnswerForm", "initiatorDataMatcher" : "data-lia-message-uid" resetMenu(); } LITHIUM.AjaxSupport.ComponentEvents.set({ var clickedDomElement = $(this); "actions" : [ "event" : "ProductMessageEdit", "action" : "rerender" "event" : "expandMessage", ] }, Bist du sicher, dass du fortfahren möchtest? } } "event" : "editProductMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_21","feedbackSelector":".InfoMessage"}); "context" : "envParam:quiltName", "actions" : [ "action" : "pulsate" "action" : "rerender" ], "context" : "", // Set start to true only if the first key in the sequence is pressed "useTruncatedSubject" : "true", "event" : "MessagesWidgetEditAction", { } { "message" : "2436952", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }); { "actions" : [ { "initiatorBinding" : true, LITHIUM.StarRating('#any_0_5', true, 2, 'LITHIUM:starRating'); { } { } "action" : "rerender" "eventActions" : [ $(document).keydown(function(e) { "context" : "", }, } "disallowZeroCount" : "false", { ] "event" : "ProductAnswerComment", { }, ] { "event" : "unapproveMessage", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "actions" : [ }, { "disableKudosForAnonUser" : "false", { "context" : "", "event" : "addThreadUserEmailSubscription", }, { { "event" : "MessagesWidgetEditAnswerForm", LITHIUM.StarRating('#any_0_6', true, 2, 'LITHIUM:starRating'); "context" : "envParam:quiltName,message,product,contextId,contextUrl", { } $(document).ready(function(){ } ] { "actions" : [ "actions" : [ { { }, "context" : "envParam:quiltName,message", "context" : "", ] { "context" : "lia-deleted-state", } "event" : "QuickReply", } "triggerEvent" : "LITHIUM:triggerDialogEvent", "actions" : [ Execute whatever should happen when entering the right sequence { "event" : "deleteMessage", ] { "actions" : [ { "event" : "MessagesWidgetEditAction", { "actions" : [ { "event" : "MessagesWidgetEditAnswerForm", "action" : "rerender" "accessibility" : false, "actions" : [ "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", "context" : "", ] { LITHIUM.AjaxSupport.fromForm('#form_5', 'GiveRating', '#ajaxfeedback_5', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); Da scheint was nicht korrekt hinterlegt zu sein. ] "context" : "envParam:entity", { "showCountOnly" : "false", "actions" : [ { "selector" : "#kudosButtonV2_8", "action" : "pulsate" ] "actions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "useSimpleView" : "false", "initiatorBinding" : true, "selector" : "#messageview_4", ] }); "message" : "2437501", auch im Post vom 18:10.2020 12:16: LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_0.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"Ztg4CZBaMBWLw18t09U9SXWD5kJ5ikmci1BLyhOwnzk. { }, }, Bist du sicher, dass du fortfahren möchtest? ] "context" : "envParam:entity", "action" : "rerender" "action" : "rerender" ] "componentId" : "kudos.widget.button", "event" : "markAsSpamWithoutRedirect", { "event" : "unapproveMessage", } "actions" : [ }, { // If watching, pay attention to key presses, looking for right sequence. "actions" : [ { }, "event" : "removeThreadUserEmailSubscription", } "action" : "rerender" "includeRepliesModerationState" : "false", { "context" : "envParam:selectedMessage", { LITHIUM.AjaxSupport.useTickets = false; "action" : "rerender" "linkDisabled" : "false" } "action" : "pulsate" { ] "componentId" : "forums.widget.message-view", ] }, "useTruncatedSubject" : "true", }, } }, "context" : "envParam:quiltName,product,contextId,contextUrl", } { LITHIUM.Dialog.options['62748831'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; "actions" : [ ] "action" : "rerender" "showCountOnly" : "false", "context" : "envParam:entity", { "parameters" : { "event" : "QuickReply", "actions" : [ "action" : "rerender" // console.log(key); ], } } { if ( neededkeys[count] == key ) { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "ProductAnswerComment", event.preventDefault(); "kudosLinksDisabled" : "false", }, "actions" : [ ] "action" : "rerender" "}); "useCountToKudo" : "false", } } "actions" : [ ] ] { LITHIUM.MessageBodyDisplay('#bodyDisplay_7', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); "actions" : [ }, LITHIUM.Dialog.options['651587383'] = {"contentContext":" \n\n\t\n\t\t\n\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\t\t\n\t\t\t\t\t\tDu hast die maximal erlaubte Anzahl von Bewertungen für einen Beitrag erreicht.\n\t\t\t\t\t\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\n\t\t\t\t\n\t\t\t\n\n\t\t\t\n\t\t","dialogOptions":{"minHeight":174,"draggable":true,"maxHeight":600,"resizable":true,"autoOpen":false,"width":310,"minWidth":310,"dialogClass":"lia-content lia-panel-dialog lia-panel-dialog-modeless-simple","position":["center","center"],"modal":false,"maxWidth":310},"contentType":"html"}; { "action" : "rerender" LITHIUM.GiveRatingForm('#give-rating-form-message_ratings-2437505 .lia-rating-control-passive', '#form_3'); LITHIUM.Auth.LOGIN_URL_TMPL = 'https://www.vodafone.de/mint/saml/2/unsolicited/sso?providerId=https%3A%2F%2Fforum.vodafone.de%2Fauth%2Fsaml&target=https%3A%2F%2FREPLACE_TEXT'; { ', 'ajax'); Verwalte Deine Verträge, Kundendaten und Geräteeinstellungen für MeinVodafone . LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ } ;(function($) { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] "actions" : [ LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); } { var count = 0; "action" : "rerender" LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_7","menuItemsSelector":".lia-menu-dropdown-items"}}); "useCountToKudo" : "false", "eventActions" : [ ], Login in den Router geht nicht. }, ] }, "selector" : "#messageview", "entity" : "2443863", "disableKudosForAnonUser" : "false", }, }, "context" : "", "context" : "", } { ] "parameters" : { var expireDate = new Date(); }, "action" : "rerender" { LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "", "action" : "pulsate" } ] "event" : "RevokeSolutionAction", } } { Falls Sie weitere Informationen zu Ihrer Vodafone-Rechnung benötigen, so finden Sie diese direkt im Internet auf der Webpage von Vodafone. } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_7","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_7","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/7001/thread-id/102688","ajaxErrorEventName":"LITHIUM:ajaxError","token":"OSXpRZmiYwYsfCs_CwB4pdvz_CWsBDEwplHs6YvUQSk. "action" : "rerender" } },